PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G107400.1.p
Common NameGLYMA_03G107400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 534aa    MW: 62049.6 Da    PI: 8.3486
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G107400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR144.35.9e-1436104171
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkke 71 
                          +fY+ YAk  GFsvrks+  ++ +  e+ ++tfvCs+ g+r+ ++++ ++ +r+++e+r+gC+a+++v+ +
  Glyma.03G107400.1.p  36 EFYCWYAKISGFSVRKSHIVRN-TCMETLQQTFVCSCAGYRRVSTSD-RRIQREKKESRCGCEAMFRVHVH 104
                          6*****************9999.66679***************9999.9999***************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-1136104IPR004330FAR1 DNA binding domain
PfamPF105511.5E-30210304IPR018289MULE transposase domain
PROSITE profilePS5096610.002460496IPR007527Zinc finger, SWIM-type
SMARTSM005750.0028471498IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MSELESSQNF SSFVNGDGDN DVTEVLNFGD LELAYEFYCW YAKISGFSVR KSHIVRNTCM  60
ETLQQTFVCS CAGYRRVSTS DRRIQREKKE SRCGCEAMFR VHVHFQLSCL LLGHRKMSAS  120
DIMQVENYRK VGIRPPHMYA TFTNQCGGYD KVGFIRKNMY NEVGRMRKQH TSDARGALKY  180
LYDLRKKDPM MYVSYTVDGG QLLYEVFGDV LAFDATYKKN KYLCPFVVFS GMNHHNQTIV  240
FAPAIVTDET EETYVWLLEQ LLVAIKGKDP CSIIADGDLA MRNAIRRVMP GVFHRLCAWH  300
LLRNALSHVR DKQVLKWLKN LMLGDFEVVK FEEKWNKMVA TFELEDNTWI AELYEKRMKW  360
SPAHLRGYFF AGIRITSHCE AFHAHVAKYV HSCTNLTDFV EQFQRCLPYF RYRVVVADYS  420
STYGNESYLS RTIKLRVIDC KEMVTFSVYW VVKYCSGSVW RVSYCPSMVD FTCSCMRMHS  480
IGLPCDHILA VLVSLNFMEL PSSLVLNRWS KVATENIKDK YPDSAIYWDS QLMA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352100.0AC235210.1 Glycine max strain Williams 82 clone GM_WBb0019I19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590087.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0R0KT330.0A0A0R0KT33_SOYBN; Uncharacterized protein (Fragment)
STRINGGLYMA11G29330.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3265734
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-63FAR1-related sequence 5